SCOPe 2.07: Domain d3dv0f2: 3dv0 F:187-324

Lineage for d3dv0f2 (3dv0 F:187-324)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.0: automated matches [227237] (1 protein)
   not a true family

6. Protein automated matches [226991] (9 species)
   not a true protein

7. Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries)

8. Domain d3dv0f2: 3dv0 F:187-324 [199292]
   Other proteins in same PDB: d3dv0a_, d3dv0b1, d3dv0c_, d3dv0d1, d3dv0e_, d3dv0f1, d3dv0g_, d3dv0h1, d3dv0i_, d3dv0j_
   automated match to d1umdb2
   complexed with k, mg, pyr, tpw

Details for d3dv0f2

PDB Entry: 3dv0, 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex

PDB Compounds: (F:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dv0f2:

Sequence; same for both SEQRES and ATOM records:

>d3dv0f2 c.48.1.0 (F:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti
igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv
wlpnfkdvietakkvmnf

Timeline for d3dv0f2:

• d3dv0f2 first appeared in SCOPe 2.03
  
• d3dv0f2 appears in SCOPe 2.06
  
• d3dv0f2 appears in the current release, SCOPe 2.08