Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries) |
Domain d3dv0f2: 3dv0 F:187-324 [199292] Other proteins in same PDB: d3dv0a_, d3dv0b1, d3dv0c_, d3dv0d1, d3dv0e_, d3dv0f1, d3dv0g_, d3dv0h1, d3dv0i_, d3dv0j_ automated match to d1umdb2 complexed with k, mg, pyr, tpw |
PDB Entry: 3dv0 (more details), 2.5 Å
SCOPe Domain Sequences for d3dv0f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dv0f2 c.48.1.0 (F:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]} eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv wlpnfkdvietakkvmnf
Timeline for d3dv0f2: