![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (21 species) not a true protein |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [226816] (3 PDB entries) |
![]() | Domain d3dv0f1: 3dv0 F:1-186 [199291] Other proteins in same PDB: d3dv0a_, d3dv0b2, d3dv0c_, d3dv0d2, d3dv0e_, d3dv0f2, d3dv0g_, d3dv0h2, d3dv0i_, d3dv0j_ automated match to d1umdb1 complexed with k, mg, pyr, tpw |
PDB Entry: 3dv0 (more details), 2.5 Å
SCOPe Domain Sequences for d3dv0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dv0f1 c.36.1.0 (F:1-186) automated matches {Bacillus stearothermophilus [TaxId: 1422]} aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr qevpeg
Timeline for d3dv0f1: