SCOPe 2.08: Domain d3dufb2: 3duf B:187-324

Lineage for d3dufb2 (3duf B:187-324)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.0: automated matches [227237] (1 protein)
   not a true family

6. Protein automated matches [226991] (9 species)
   not a true protein

7. Species Bacillus stearothermophilus [TaxId:1422] [225586] (3 PDB entries)

8. Domain d3dufb2: 3duf B:187-324 [199278]
   Other proteins in same PDB: d3dufa_, d3dufb1, d3dufc_, d3dufd1, d3dufe_, d3duff1, d3dufg_, d3dufh1, d3dufi_, d3dufj_
   automated match to d1umdb2
   complexed with k, mg, r1t

Details for d3dufb2

PDB Entry: 3duf, 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta

SCOPe Domain Sequences for d3dufb2:

Sequence; same for both SEQRES and ATOM records:

>d3dufb2 c.48.1.0 (B:187-324) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
eytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldieti
igsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesv
wlpnfkdvietakkvmnf

Timeline for d3dufb2:

• d3dufb2 first appeared in SCOPe 2.03
  
• d3dufb2 appears in SCOPe 2.07