SCOPe 2.06: Domain d3doka2: 3dok A:430-539

Lineage for d3doka2 (3dok A:430-539)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)

8. Domain d3doka2: 3dok A:430-539 [199256]
   Other proteins in same PDB: d3doka1, d3dokb_
   automated match to d1bqna1
   complexed with gwj, po4; mutant

Details for d3doka2

PDB Entry: 3dok, 2.9 Å

PDB Description: crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3doka2:

Sequence; same for both SEQRES and ATOM records:

>d3doka2 c.55.3.0 (A:430-539) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d3doka2:

• d3doka2 first appeared in SCOPe 2.03
  
• d3doka2 appears in SCOPe 2.05
  
• d3doka2 appears in SCOPe 2.07
  
• d3doka2 appears in the current release, SCOPe 2.08