SCOPe 2.06: Domain d3dlka2: 3dlk A:430-554

Lineage for d3dlka2 (3dlk A:430-554)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries)

8. Domain d3dlka2: 3dlk A:430-554 [199252]
   Other proteins in same PDB: d3dlka1, d3dlkb_
   automated match to d1bqna1
   complexed with so4

Details for d3dlka2

PDB Entry: 3dlk, 1.85 Å

PDB Description: crystal structure of an engineered form of the hiv-1 reverse transcriptase, rt69a

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3dlka2:

Sequence; same for both SEQRES and ATOM records:

>d3dlka2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d3dlka2:

• d3dlka2 first appeared in SCOPe 2.03
  
• d3dlka2 appears in SCOPe 2.05
  
• d3dlka2 appears in SCOPe 2.07
  
• d3dlka2 appears in the current release, SCOPe 2.08