SCOP 1.61: Domain d1frgh1: 1frg H:218-336

Lineage for d1frgh1 (1frg H:218-336)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 26/9 (mouse), kappa L chain [48783] (1 PDB entry)

8. Domain d1frgh1: 1frg H:218-336 [19925]
   Other proteins in same PDB: d1frgh2, d1frgl2

Details for d1frgh1

PDB Entry: 1frg, 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

SCOP Domain Sequences for d1frgh1:

Sequence; same for both SEQRES and ATOM records:

>d1frgh1 b.1.1.1 (H:218-336) Immunoglobulin (variable domains of L and H chains) {Fab 26/9 (mouse), kappa L chain}
evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvs

Timeline for d1frgh1:

• d1frgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1frgh1 appears in SCOP 1.59
  
• d1frgh1 appears in SCOP 1.63
  
• d1frgh1 appears in the current release, SCOPe 2.08