| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab 26/9 (mouse), kappa L chain [48783] (1 PDB entry) |
| Domain d1frgh1: 1frg H:218-336 [19925] Other proteins in same PDB: d1frgh2, d1frgl2 |
PDB Entry: 1frg (more details), 2.8 Å
SCOP Domain Sequences for d1frgh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frgh1 b.1.1.1 (H:218-336) Immunoglobulin (variable domains of L and H chains) {Fab 26/9 (mouse), kappa L chain}
evllvesggdlvkpggflklscaasgftfssfgmswvrhtpdkrlewvatisngggytyy
qdsvkgrftisrdnakntlflemtslksedaglyycarrerydekgfaywgrgtlvtvs
Timeline for d1frgh1: