Lineage for d1frgl1 (1frg L:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451904Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)
  8. 451941Domain d1frgl1: 1frg L:1-113 [19924]
    Other proteins in same PDB: d1frgh1, d1frgh2, d1frgl2
    part of Fab 26/9

Details for d1frgl1

PDB Entry: 1frg (more details), 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

SCOP Domain Sequences for d1frgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frgl1 b.1.1.1 (L:1-113) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspssltvtagekvtmsckssqslfnsgkrknfltwyhqkpgqppklliywastr
esgvpdrfsgsgsgtdftltitsvqaedlaiyycqndyshpltfgagtklelk

SCOP Domain Coordinates for d1frgl1:

Click to download the PDB-style file with coordinates for d1frgl1.
(The format of our PDB-style files is described here.)

Timeline for d1frgl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1frgl2