SCOPe 2.06: Domain d3difa2: 3dif A:108-213

Lineage for d3difa2 (3dif A:108-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d3difa2: 3dif A:108-213 [199237]
   Other proteins in same PDB: d3difa1, d3difb1, d3difc1, d3difd1
   automated match to d1dqdl2

Details for d3difa2

PDB Entry: 3dif, 2.4 Å

PDB Description: crystal structure of fabox117

PDB Compounds: (A:) FabOX117 Light Chain Fragment

SCOPe Domain Sequences for d3difa2:

Sequence; same for both SEQRES and ATOM records:

>d3difa2 b.1.1.2 (A:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3difa2:

• d3difa2 first appeared in SCOPe 2.03
  
• d3difa2 appears in SCOPe 2.05
  
• d3difa2 appears in SCOPe 2.07
  
• d3difa2 appears in the current release, SCOPe 2.08