Lineage for d3difa1 (3dif A:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519751Domain d3difa1: 3dif A:1-107 [199236]
    Other proteins in same PDB: d3difa2, d3difb1, d3difc2, d3difd1
    automated match to d1dqdl1

Details for d3difa1

PDB Entry: 3dif (more details), 2.4 Å

PDB Description: crystal structure of fabox117
PDB Compounds: (A:) FabOX117 Light Chain Fragment

SCOPe Domain Sequences for d3difa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3difa1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divitqspkfmstsvgdrvsitckasqdvstavawfqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhystpwtfgggtkleik

SCOPe Domain Coordinates for d3difa1:

Click to download the PDB-style file with coordinates for d3difa1.
(The format of our PDB-style files is described here.)

Timeline for d3difa1: