Lineage for d1figh1 (1fig H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510931Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1511146Domain d1figh1: 1fig H:1-113 [19923]
    Other proteins in same PDB: d1figh2, d1figl1, d1figl2
    part of catalytic antibody 1F7 with chorismate mutase activity
    complexed with tsa

Details for d1figh1

PDB Entry: 1fig (more details), 3 Å

PDB Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
PDB Compounds: (H:) igg1-kappa 1f7 fab (heavy chain)

SCOPe Domain Sequences for d1figh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1figh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
dvqlqqsgpelekpgasvkisckasgfslpghninwivqrngkslewignidpyyggtnf
npkfkgkatltvdkssstlymhltslqsedsavyycarrrdgnygftywgqgtlvtvsa

SCOPe Domain Coordinates for d1figh1:

Click to download the PDB-style file with coordinates for d1figh1.
(The format of our PDB-style files is described here.)

Timeline for d1figh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1figh2