SCOP 1.67: Domain d1figh1: 1fig H:1-113

Lineage for d1figh1 (1fig H:1-113)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)

8. Domain d1figh1: 1fig H:1-113 [19923]
   Other proteins in same PDB: d1figh2, d1figl1, d1figl2
   part of catalytic antibody 1F7 with chorismate mutase activity
   complexed with tsa

Details for d1figh1

PDB Entry: 1fig, 3 Å

PDB Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart

SCOP Domain Sequences for d1figh1:

Sequence; same for both SEQRES and ATOM records:

>d1figh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
dvqlqqsgpelekpgasvkisckasgfslpghninwivqrngkslewignidpyyggtnf
npkfkgkatltvdkssstlymhltslqsedsavyycarrrdgnygftywgqgtlvtvsa

Timeline for d1figh1:

• d1figh1 first appeared (with stable ids) in SCOP 1.55
  
• d1figh1 appears in SCOP 1.65
  
• d1figh1 appears in SCOP 1.69
  
• d1figh1 appears in the current release, SCOPe 2.08