SCOPe 2.05: Domain d1figl1: 1fig L:1-108

Lineage for d1figl1 (1fig L:1-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)

8. Domain d1figl1: 1fig L:1-108 [19922]
   Other proteins in same PDB: d1figh1, d1figh2, d1figl2
   part of catalytic antibody 1F7 with chorismate mutase activity
   complexed with tsa

Details for d1figl1

PDB Entry: 1fig, 3 Å

PDB Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart

PDB Compounds: (L:) igg1-kappa 1f7 fab (light chain)

SCOPe Domain Sequences for d1figl1:

Sequence; same for both SEQRES and ATOM records:

>d1figl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
envltqspaimsaspgekvtmacrasssvsstylhwyqqksgaspklliystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqysgypltfgagtklelkr

Timeline for d1figl1:

• d1figl1 first appeared (with stable ids) in SCOP 1.55
  
• d1figl1 appears in SCOPe 2.04
  
• d1figl1 appears in SCOPe 2.06
  
• d1figl1 appears in the current release, SCOPe 2.08