Lineage for d3cvil1 (3cvi L:1-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766662Domain d3cvil1: 3cvi L:1-106 [199218]
    Other proteins in same PDB: d3cvih1, d3cvil2
    automated match to d1c12a1

Details for d3cvil1

PDB Entry: 3cvi (more details), 1.8 Å

PDB Description: How TCR-like antibody recognizes MHC-bound peptide
PDB Compounds: (L:) 25-D1.16 Light chain

SCOPe Domain Sequences for d3cvil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvil1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqvtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpdr
fsgsgsrkdytliitslqtedvatyycqqywstpltfgagtklelk

SCOPe Domain Coordinates for d3cvil1:

Click to download the PDB-style file with coordinates for d3cvil1.
(The format of our PDB-style files is described here.)

Timeline for d3cvil1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cvil2
View in 3D
Domains from other chains:
(mouse over for more information)
d3cvih1