SCOP 1.55: Domain d1cgsh1: 1cgs H:1-117

Lineage for d1cgsh1 (1cgs H:1-117)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab, anti-sweetener (mouse), kappa L chain [48781] (2 PDB entries)

8. Domain d1cgsh1: 1cgs H:1-117 [19921]
   Other proteins in same PDB: d1cgsh2, d1cgsl2

Details for d1cgsh1

PDB Entry: 1cgs, 2.6 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d1cgsh1:

Sequence; same for both SEQRES and ATOM records:

>d1cgsh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain}
rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny
rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaa

Timeline for d1cgsh1:

• d1cgsh1 appears in SCOP 1.57
  
• d1cgsh1 appears in the current release, SCOPe 2.08