SCOPe 2.06: Domain d3crna1: 3crn A:2-122

Lineage for d3crna1 (3crn A:2-122)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Methanospirillum hungatei [TaxId:323259] [188365] (2 PDB entries)

8. Domain d3crna1: 3crn A:2-122 [199203]
   Other proteins in same PDB: d3crna2, d3crna3, d3crnb2, d3crnb3
   automated match to d3crnb_
   complexed with gol, na

Details for d3crna1

PDB Entry: 3crn, 1.58 Å

PDB Description: crystal structure of response regulator receiver domain protein (chey- like) from methanospirillum hungatei jf-1

PDB Compounds: (A:) Response regulator receiver domain protein, CheY-like

SCOPe Domain Sequences for d3crna1:

Sequence; same for both SEQRES and ATOM records:

>d3crna1 c.23.1.0 (A:2-122) automated matches {Methanospirillum hungatei [TaxId: 323259]}
krilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdmegt
ellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikekldeqe
k

Timeline for d3crna1:

• d3crna1 first appeared in SCOPe 2.03, called d3crna_
  
• d3crna1 was called d3crna_ in SCOPe 2.05
  
• d3crna1 appears in SCOPe 2.07
  
• d3crna1 appears in the current release, SCOPe 2.08