Lineage for d1cgsl1 (1cgs L:1-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288823Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 1288977Domain d1cgsl1: 1cgs L:1-112 [19920]
    Other proteins in same PDB: d1cgsh1, d1cgsh2, d1cgsl2
    part of an anti-sweetener Fab

Details for d1cgsl1

PDB Entry: 1cgs (more details), 2.6 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab
PDB Compounds: (L:) igg2b-kappa nc6.8 fab (light chain)

SCOPe Domain Sequences for d1cgsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgsl1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
elvmtqsplslpvslgdqasiscrpsqslvhsngntylhwylqkpgqspklliyrvsnrf
sgvpdrfsgsgsgtaftlkisrveaedlgvyfcsqgthvpytfgggtklelk

SCOPe Domain Coordinates for d1cgsl1:

Click to download the PDB-style file with coordinates for d1cgsl1.
(The format of our PDB-style files is described here.)

Timeline for d1cgsl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cgsl2