SCOPe 2.05: Domain d3cipa1: 3cip A:5-146

Lineage for d3cipa1 (3cip A:5-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Dictyostelium discoideum [225499] (2 PDB entries)

8. Domain d3cipa1: 3cip A:5-146 [199190]
   Other proteins in same PDB: d3cipa2, d3cipg_
   automated match to d1d4xa1
   complexed with atp, ca, gol, mg, so4

Details for d3cipa1

PDB Entry: 3cip, 1.6 Å

PDB Description: complex of dictyostelium discoideum actin with gelsolin

PDB Compounds: (A:) Major actin

SCOPe Domain Sequences for d3cipa1:

Sequence, based on SEQRES records:

>d3cipa1 c.55.1.0 (A:5-146) automated matches {Dictyostelium discoideum}
vqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3cipa1 c.55.1.0 (A:5-146) automated matches {Dictyostelium discoideum}
vqalvidngsgmckagfagddapravfpsivgrprhtkdsyvgdeaqskrgiltlkypie
hgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpam
yvaiqavlslyasg

Timeline for d3cipa1:

• d3cipa1 first appeared in SCOPe 2.03
  
• d3cipa1 appears in SCOPe 2.04
  
• d3cipa1 appears in SCOPe 2.06
  
• d3cipa1 appears in the current release, SCOPe 2.08