Lineage for d2cgrh1 (2cgr H:1-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510931Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1511007Domain d2cgrh1: 2cgr H:1-117 [19919]
    Other proteins in same PDB: d2cgrh2, d2cgrl1, d2cgrl2
    part of an anti-sweetener Fab
    complexed with gas

Details for d2cgrh1

PDB Entry: 2cgr (more details), 2.2 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab
PDB Compounds: (H:) igg2b-kappa nc6.8 fab (heavy chain)

SCOPe Domain Sequences for d2cgrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgrh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny
rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaa

SCOPe Domain Coordinates for d2cgrh1:

Click to download the PDB-style file with coordinates for d2cgrh1.
(The format of our PDB-style files is described here.)

Timeline for d2cgrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cgrh2