Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab, anti-sweetener (mouse), kappa L chain [48781] (2 PDB entries) |
Domain d2cgrh1: 2cgr H:1-117 [19919] Other proteins in same PDB: d2cgrh2, d2cgrl2 complexed with gas |
PDB Entry: 2cgr (more details), 2.2 Å
SCOP Domain Sequences for d2cgrh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgrh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain} rvqllesgaelmkpgasvqisckatgytfseywiewvkerpghglewigeilpgsgrtny rekfkgkatftadtssntaymqlssltsedsavyyctrgyssmdywgqgtsvtvsaa
Timeline for d2cgrh1: