Lineage for d3cfif_ (3cfi F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024592Domain d3cfif_: 3cfi F: [199177]
    Other proteins in same PDB: d3cfia_, d3cfib_, d3cfid_, d3cfie_, d3cfig_, d3cfih_, d3cfij_, d3cfik_
    automated match to d3ezjb_
    complexed with cl

Details for d3cfif_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (F:) Nanobody NBEPSIJ_11

SCOPe Domain Sequences for d3cfif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfif_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyta
pvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtv

SCOPe Domain Coordinates for d3cfif_:

Click to download the PDB-style file with coordinates for d3cfif_.
(The format of our PDB-style files is described here.)

Timeline for d3cfif_: