SCOPe 2.03: Domain d2virb1: 2vir B:1-120

Lineage for d2virb1 (2vir B:1-120)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d2virb1: 2vir B:1-120 [19917]
   Other proteins in same PDB: d2vira1, d2vira2, d2virb2, d2virc_
   part of Fab HC19
   complexed with zn

Details for d2virb1

PDB Entry: 2vir, 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

PDB Compounds: (B:) immunoglobulin (igg1, lambda)

SCOPe Domain Sequences for d2virb1:

Sequence; same for both SEQRES and ATOM records:

>d2virb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

Timeline for d2virb1:

• d2virb1 first appeared (with stable ids) in SCOP 1.55
  
• d2virb1 appears in SCOPe 2.02
  
• d2virb1 appears in SCOPe 2.04
  
• d2virb1 appears in the current release, SCOPe 2.08