Lineage for d2virb1 (2vir B:1-120)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451450Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (35 PDB entries)
  8. 451494Domain d2virb1: 2vir B:1-120 [19917]
    Other proteins in same PDB: d2vira1, d2vira2, d2virb2, d2virc_
    part of Fab HC19

Details for d2virb1

PDB Entry: 2vir (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d2virb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2virb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

SCOP Domain Coordinates for d2virb1:

Click to download the PDB-style file with coordinates for d2virb1.
(The format of our PDB-style files is described here.)

Timeline for d2virb1: