Lineage for d2virb1 (2vir B:1-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102724Species Fab HC19 (mouse), lambda L chain [48780] (4 PDB entries)
  8. 102732Domain d2virb1: 2vir B:1-120 [19917]
    Other proteins in same PDB: d2vira2, d2virb2, d2virc_

Details for d2virb1

PDB Entry: 2vir (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d2virb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2virb1 b.1.1.1 (B:1-120) Immunoglobulin (variable domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

SCOP Domain Coordinates for d2virb1:

Click to download the PDB-style file with coordinates for d2virb1.
(The format of our PDB-style files is described here.)

Timeline for d2virb1: