Lineage for d3c14a_ (3c14 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197663Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197664Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2197692Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 2197693Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries)
    Uniprot P30803 458-646
  8. 2197701Domain d3c14a_: 3c14 A: [199144]
    Other proteins in same PDB: d3c14b_, d3c14c1, d3c14c2
    automated match to d1cs4a_
    complexed with ca, cl, fok, gsp, mg, pop

Details for d3c14a_

PDB Entry: 3c14 (more details), 2.68 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
PDB Compounds: (A:) Adenylate cyclase type 5

SCOPe Domain Sequences for d3c14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c14a_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOPe Domain Coordinates for d3c14a_:

Click to download the PDB-style file with coordinates for d3c14a_.
(The format of our PDB-style files is described here.)

Timeline for d3c14a_: