SCOPe 2.05: Domain d3c08l1: 3c08 L:4-106

Lineage for d3c08l1 (3c08 L:4-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3c08l1: 3c08 L:4-106 [199142]
   Other proteins in same PDB: d3c08h1, d3c08h2, d3c08l2
   automated match to d1rhha1
   complexed with so4

Details for d3c08l1

PDB Entry: 3c08, 2.15 Å

PDB Description: crystal structure the fab fragment of matuzumab/emd72000 (fab72000)

PDB Compounds: (L:) Matuzumab Fab Light chain

SCOPe Domain Sequences for d3c08l1:

Sequence, based on SEQRES records:

>d3c08l1 b.1.1.0 (L:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqspsslsasvgdrvtitcsasssvtymywyqqkpgkapklliydtsnlasgvpsrfsg
sgsgtdytftisslqpediatyycqqwsshiftfgqgtkveik

Sequence, based on observed residues (ATOM records):

>d3c08l1 b.1.1.0 (L:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqspsslsasvgdrvtitcsasvtymywyqqkpgkapklliydtsnlasgvpsrfsgsg
sgtdytftisslqpediatyycqqwsshiftfgqgtkveik

Timeline for d3c08l1:

• d3c08l1 first appeared in SCOPe 2.03
  
• d3c08l1 appears in SCOPe 2.04
  
• d3c08l1 appears in SCOPe 2.06
  
• d3c08l1 appears in the current release, SCOPe 2.08