Lineage for d2vita1 (2vit A:1-110)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354589Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2354681Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2354714Domain d2vita1: 2vit A:1-110 [19914]
    Other proteins in same PDB: d2vita2, d2vitb1, d2vitb2, d2vitc_
    part of Fab HC19
    complexed with zn; mutant

Details for d2vita1

PDB Entry: 2vit (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody
PDB Compounds: (A:) immunoglobulin (igg1, lambda)

SCOPe Domain Sequences for d2vita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vita1 b.1.1.1 (A:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOPe Domain Coordinates for d2vita1:

Click to download the PDB-style file with coordinates for d2vita1.
(The format of our PDB-style files is described here.)

Timeline for d2vita1: