SCOPe 2.06: Domain d2vita1: 2vit A:1-110

Lineage for d2vita1 (2vit A:1-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)

8. Domain d2vita1: 2vit A:1-110 [19914]
   Other proteins in same PDB: d2vita2, d2vitb1, d2vitb2, d2vitc_
   part of Fab HC19
   complexed with zn; mutant

Details for d2vita1

PDB Entry: 2vit, 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody

PDB Compounds: (A:) immunoglobulin (igg1, lambda)

SCOPe Domain Sequences for d2vita1:

Sequence; same for both SEQRES and ATOM records:

>d2vita1 b.1.1.1 (A:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

Timeline for d2vita1:

• d2vita1 first appeared (with stable ids) in SCOP 1.55
  
• d2vita1 appears in SCOPe 2.05
  
• d2vita1 appears in SCOPe 2.07
  
• d2vita1 appears in the current release, SCOPe 2.08