SCOP 1.63: Domain d2vita1: 2vit A:1-110

Lineage for d2vita1 (2vit A:1-110)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab HC19 (mouse), lambda L chain [48780] (4 PDB entries)

8. Domain d2vita1: 2vit A:1-110 [19914]
   Other proteins in same PDB: d2vita2, d2vitb2, d2vitc_

Details for d2vita1

PDB Entry: 2vit, 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2vita1:

Sequence; same for both SEQRES and ATOM records:

>d2vita1 b.1.1.1 (A:1-110) Immunoglobulin (variable domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

Timeline for d2vita1:

• d2vita1 first appeared (with stable ids) in SCOP 1.55
  
• d2vita1 appears in SCOP 1.61
  
• d2vita1 appears in SCOP 1.65
  
• d2vita1 appears in the current release, SCOPe 2.08