Lineage for d2vita1 (2vit A:1-110)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7698Species Fab HC19 (mouse), lambda L chain [48780] (4 PDB entries)
  8. 7703Domain d2vita1: 2vit A:1-110 [19914]
    Other proteins in same PDB: d2vita2, d2vitb2, d2vitc_

Details for d2vita1

PDB Entry: 2vit (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2vita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vita1 b.1.1.1 (A:1-110) Immunoglobulin (variable domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOP Domain Coordinates for d2vita1:

Click to download the PDB-style file with coordinates for d2vita1.
(The format of our PDB-style files is described here.)

Timeline for d2vita1: