| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) ![]() automatically mapped to Pfam PF02532 |
| Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
| Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161044] (7 PDB entries) Uniprot Q8DJZ6 1-35 |
| Domain d3bz1i_: 3bz1 I: [199134] Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpkrk
Timeline for d3bz1i_: