Lineage for d3bz1i_ (3bz1 I:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457596Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 1457597Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 1457598Protein Photosystem II reaction center protein I, PsbI [161043] (2 species)
  7. 1457599Species Thermosynechococcus elongatus [TaxId:146786] [161044] (3 PDB entries)
    Uniprot Q8DJZ6 1-35
  8. 1457601Domain d3bz1i_: 3bz1 I: [199134]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1z_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1i_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d3bz1i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpkrk

SCOPe Domain Coordinates for d3bz1i_:

Click to download the PDB-style file with coordinates for d3bz1i_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1i_: