![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) ![]() automatically mapped to Pfam PF02532 |
![]() | Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
![]() | Protein Photosystem II reaction center protein I, PsbI [161043] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161044] (3 PDB entries) Uniprot Q8DJZ6 1-35 |
![]() | Domain d3bz1i_: 3bz1 I: [199134] Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1z_ automated match to d2axti1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]} metlkitvyivvtffvllfvfgflsgdparnpkrk
Timeline for d3bz1i_: