SCOPe 2.03: Domain d3bytf1: 3byt F:2-118

Lineage for d3bytf1 (3byt F:2-118)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein automated matches [226992] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225594] (7 PDB entries)

8. Domain d3bytf1: 3byt F:2-118 [199128]
   Other proteins in same PDB: d3byta_, d3bytb2, d3bytc_, d3bytd2, d3byte_, d3bytf2, d3bytg_, d3byth2
   automated match to d1i4pa1

Details for d3bytf1

PDB Entry: 3byt, 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2

PDB Compounds: (F:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bytf1:

Sequence, based on SEQRES records:

>d3bytf1 b.40.2.2 (F:2-118) automated matches {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg

Sequence, based on observed residues (ATOM records):

>d3bytf1 b.40.2.2 (F:2-118) automated matches {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdtwhgktcmyggitkheg

Timeline for d3bytf1:

• d3bytf1 is new in SCOPe 2.03-stable
  
• d3bytf1 appears in SCOPe 2.04
  
• d3bytf1 appears in the current release, SCOPe 2.08