Lineage for d3bytf1 (3byt F:2-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789011Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2789012Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2789023Domain d3bytf1: 3byt F:2-118 [199128]
    Other proteins in same PDB: d3byta_, d3bytb2, d3bytc_, d3bytd2, d3byte_, d3bytf2, d3bytg_, d3byth2
    automated match to d1i4pa1

Details for d3bytf1

PDB Entry: 3byt (more details), 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2
PDB Compounds: (F:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bytf1:

Sequence, based on SEQRES records: (download)

>d3bytf1 b.40.2.2 (F:2-118) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d3bytf1 b.40.2.2 (F:2-118) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdtwhgktcmyggitkheg

SCOPe Domain Coordinates for d3bytf1:

Click to download the PDB-style file with coordinates for d3bytf1.
(The format of our PDB-style files is described here.)

Timeline for d3bytf1: