Lineage for d3bytd1 (3byt D:2-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314454Protein automated matches [226992] (1 species)
    not a true protein
  7. 1314455Species Staphylococcus aureus [TaxId:1280] [225594] (7 PDB entries)
  8. 1314462Domain d3bytd1: 3byt D:2-118 [199126]
    Other proteins in same PDB: d3byta_, d3bytb2, d3bytc_, d3bytd2, d3byte_, d3bytf2, d3bytg_, d3byth2
    automated match to d1i4pa1

Details for d3bytd1

PDB Entry: 3byt (more details), 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bytd1:

Sequence, based on SEQRES records: (download)

>d3bytd1 b.40.2.2 (D:2-118) automated matches {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnkastwhgktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d3bytd1 b.40.2.2 (D:2-118) automated matches {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfssstwhgktcmyggitkheg

SCOPe Domain Coordinates for d3bytd1:

Click to download the PDB-style file with coordinates for d3bytd1.
(The format of our PDB-style files is described here.)

Timeline for d3bytd1: