Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries) Uniprot P23313 |
Domain d3bytb2: 3byt B:119-237 [199125] Other proteins in same PDB: d3byta_, d3bytb1, d3bytc_, d3bytd1, d3byte_, d3bytf1, d3bytg_, d3byth1 automated match to d1i4pa2 |
PDB Entry: 3byt (more details), 2.3 Å
SCOPe Domain Sequences for d3bytb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bytb2 d.15.6.1 (B:119-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d3bytb2: