SCOPe 2.08: Domain d3buzb2: 3buz B:147-374

Lineage for d3buzb2 (3buz B:147-374)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d3buzb2: 3buz B:147-374 [199122]
   Other proteins in same PDB: d3buza1, d3buza2
   automated match to d1qz5a2
   complexed with atp, ca, lar, tad

Details for d3buzb2

PDB Entry: 3buz, 2.81 Å

PDB Description: Crystal structure of ia-bTAD-actin complex

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3buzb2:

Sequence; same for both SEQRES and ATOM records:

>d3buzb2 c.55.1.1 (B:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

Timeline for d3buzb2:

• d3buzb2 first appeared in SCOPe 2.03
  
• d3buzb2 appears in SCOPe 2.07