SCOPe 2.06: Domain d3bplb1: 3bpl B:2-96

Lineage for d3bplb1 (3bpl B:2-96)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)

8. Domain d3bplb1: 3bpl B:2-96 [199113]
   Other proteins in same PDB: d3bpla_, d3bplb3, d3bplc1, d3bplc2
   automated match to d1iarb1
   complexed with nag

Details for d3bplb1

PDB Entry: 3bpl, 2.93 Å

PDB Description: crystal structure of the il4-il4r-common gamma ternary complex

PDB Compounds: (B:) Interleukin-4 receptor alpha chain

SCOPe Domain Sequences for d3bplb1:

Sequence; same for both SEQRES and ATOM records:

>d3bplb1 b.1.2.1 (B:2-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvlqeptcvsdymsistcewkmngptqcstelrllyqlvfllseahtcipennggagcvc
hllmddvvsadqytldlwagqqllwkgsfkpsehv

Timeline for d3bplb1:

• d3bplb1 first appeared in SCOPe 2.03
  
• d3bplb1 appears in SCOPe 2.05
  
• d3bplb1 appears in SCOPe 2.07
  
• d3bplb1 appears in the current release, SCOPe 2.08