SCOPe 2.07: Domain d3bkml2: 3bkm L:107-212

Lineage for d3bkml2 (3bkm L:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (776 PDB entries)

8. Domain d3bkml2: 3bkm L:107-212 [199102]
   Other proteins in same PDB: d3bkmh1
   automated match to d1blna2
   complexed with na, zn

Details for d3bkml2

PDB Entry: 3bkm, 1.6 Å

PDB Description: Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)

PDB Compounds: (L:) WO2 IgG2a Fab fragment Light Chain Kappa

SCOPe Domain Sequences for d3bkml2:

Sequence; same for both SEQRES and ATOM records:

>d3bkml2 b.1.1.0 (L:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3bkml2:

• d3bkml2 first appeared in SCOPe 2.03
  
• d3bkml2 appears in SCOPe 2.06