SCOPe 2.08: Domain d1gigl1: 1gig L:1-110

Lineage for d1gigl1 (1gig L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)

8. Domain d1gigl1: 1gig L:1-110 [19910]
   Other proteins in same PDB: d1gigh1, d1gigh2, d1gigl2
   part of Fab HC19

Details for d1gigl1

PDB Entry: 1gig, 2.3 Å

PDB Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody

PDB Compounds: (L:) igg1-kappa hc19 fab (light chain)

SCOPe Domain Sequences for d1gigl1:

Sequence; same for both SEQRES and ATOM records:

>d1gigl1 b.1.1.1 (L:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

Timeline for d1gigl1:

• d1gigl1 first appeared (with stable ids) in SCOP 1.55
  
• d1gigl1 appears in SCOPe 2.07