SCOPe 2.04: Domain d3bdwb_: 3bdw B:

Lineage for d3bdwb_ (3bdw B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)

8. Domain d3bdwb_: 3bdw B: [199086]
   Other proteins in same PDB: d3bdwa_, d3bdwc_
   automated match to d1fm5a_

Details for d3bdwb_

PDB Entry: 3bdw, 2.5 Å

PDB Description: human cd94/nkg2a

PDB Compounds: (B:) NKG2-A/NKG2-B type II integral membrane protein

SCOPe Domain Sequences for d3bdwb_:

Sequence, based on SEQRES records:

>d3bdwb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arhcghcpeewitysnscyyigkerrtweesllactsknssllsidneeemkflsiisps
swigvfrnsshhpwvtmnglafkheikdsdnaelncavlqvnrlksaqcgssiiyhckhk

Sequence, based on observed residues (ATOM records):

>d3bdwb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arhcghcpeewitysnscyyigkerrtweesllactsknssllsidneeemkflsiisps
swigvfrnsshhpwvtmnglafkheikaelncavlqvnrlksaqcgssiiyhckhk

Timeline for d3bdwb_:

• d3bdwb_ first appeared in SCOPe 2.03
  
• d3bdwb_ appears in SCOPe 2.05
  
• d3bdwb_ appears in the current release, SCOPe 2.08