Lineage for d3b9la3 (3b9l A:3-196)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730255Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2730256Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
    Uniprot P02768 29-596
  8. 2730373Domain d3b9la3: 3b9l A:3-196 [199081]
    automated match to d1n5ua1
    complexed with azz, myr

Details for d3b9la3

PDB Entry: 3b9l (more details), 2.6 Å

PDB Description: Human serum albumin complexed with myristate and AZT
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3b9la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9la3 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

SCOPe Domain Coordinates for d3b9la3:

Click to download the PDB-style file with coordinates for d3b9la3.
(The format of our PDB-style files is described here.)

Timeline for d3b9la3: