SCOPe 2.05: Domain d3b9kl2: 3b9k L:108-214

Lineage for d3b9kl2 (3b9k L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rat (Rattus rattus) [TaxId:10117] [225552] (1 PDB entry)

8. Domain d3b9kl2: 3b9k L:108-214 [199080]
   Other proteins in same PDB: d3b9ka_, d3b9kb_, d3b9kc1, d3b9ke_, d3b9kf_, d3b9kl1
   automated match to d1c5da2
   complexed with nag

Details for d3b9kl2

PDB Entry: 3b9k, 2.7 Å

PDB Description: crystal structure of cd8alpha-beta in complex with yts 156.7 fab

PDB Compounds: (L:) Fab heavy chain

SCOPe Domain Sequences for d3b9kl2:

Sequence; same for both SEQRES and ATOM records:

>d3b9kl2 b.1.1.0 (L:108-214) automated matches {Rat (Rattus rattus) [TaxId: 10117]}
radaaptvsifppsmeqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnrgec

Timeline for d3b9kl2:

• d3b9kl2 first appeared in SCOPe 2.03
  
• d3b9kl2 appears in SCOPe 2.04
  
• d3b9kl2 appears in SCOPe 2.06
  
• d3b9kl2 appears in the current release, SCOPe 2.08