Lineage for d3b9kc2 (3b9k C:108-214)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767504Species Rat (Rattus rattus) [TaxId:10117] [225552] (1 PDB entry)
  8. 1767505Domain d3b9kc2: 3b9k C:108-214 [199078]
    Other proteins in same PDB: d3b9ka_, d3b9kb_, d3b9kc1, d3b9ke_, d3b9kf_, d3b9kl1
    automated match to d1c5da2
    complexed with nag

Details for d3b9kc2

PDB Entry: 3b9k (more details), 2.7 Å

PDB Description: crystal structure of cd8alpha-beta in complex with yts 156.7 fab
PDB Compounds: (C:) Fab heavy chain

SCOPe Domain Sequences for d3b9kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9kc2 b.1.1.0 (C:108-214) automated matches {Rat (Rattus rattus) [TaxId: 10117]}
radaaptvsifppsmeqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnrgec

SCOPe Domain Coordinates for d3b9kc2:

Click to download the PDB-style file with coordinates for d3b9kc2.
(The format of our PDB-style files is described here.)

Timeline for d3b9kc2: