Lineage for d3b8he4 (3b8h E:561-725)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401401Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1401402Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 1401403Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries)
    Uniprot P32324
  8. 1401413Domain d3b8he4: 3b8h E:561-725 [199073]
    Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha3, d3b8ha5, d3b8hb_, d3b8hc1, d3b8hc2, d3b8hc3, d3b8hc5, d3b8hd_, d3b8he1, d3b8he2, d3b8he3, d3b8he5, d3b8hf_
    automated match to d1n0vc3
    protein/RNA complex; complexed with nad

Details for d3b8he4

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d3b8he4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8he4 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d3b8he4:

Click to download the PDB-style file with coordinates for d3b8he4.
(The format of our PDB-style files is described here.)

Timeline for d3b8he4: