![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries) Uniprot P32324 |
![]() | Domain d3b8he4: 3b8h E:561-725 [199073] Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha3, d3b8ha5, d3b8hb_, d3b8hc1, d3b8hc2, d3b8hc3, d3b8hc5, d3b8hd_, d3b8he1, d3b8he2, d3b8he3, d3b8he5, d3b8hf_ automated match to d1n0vc3 protein/RNA complex; complexed with nad |
PDB Entry: 3b8h (more details), 2.5 Å
SCOPe Domain Sequences for d3b8he4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8he4 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d3b8he4:
![]() Domains from same chain: (mouse over for more information) d3b8he1, d3b8he2, d3b8he3, d3b8he5 |