Lineage for d3b8he2 (3b8h E:344-481)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062653Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species)
  7. 2062654Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 2062664Domain d3b8he2: 3b8h E:344-481 [199071]
    Other proteins in same PDB: d3b8ha1, d3b8ha3, d3b8ha4, d3b8ha5, d3b8hb1, d3b8hb2, d3b8hc1, d3b8hc3, d3b8hc4, d3b8hc5, d3b8hd1, d3b8hd2, d3b8he1, d3b8he3, d3b8he4, d3b8he5, d3b8hf1, d3b8hf2
    automated match to d1n0vc1
    protein/RNA complex; complexed with nad

Details for d3b8he2

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d3b8he2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8he2 b.43.3.1 (E:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d3b8he2:

Click to download the PDB-style file with coordinates for d3b8he2.
(The format of our PDB-style files is described here.)

Timeline for d3b8he2: