![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries) Uniprot P32324 |
![]() | Domain d3b8he1: 3b8h E:2-343 [199070] Other proteins in same PDB: d3b8ha2, d3b8ha3, d3b8ha4, d3b8ha5, d3b8hb1, d3b8hb2, d3b8hc2, d3b8hc3, d3b8hc4, d3b8hc5, d3b8hd1, d3b8hd2, d3b8he2, d3b8he3, d3b8he4, d3b8he5, d3b8hf1, d3b8hf2 automated match to d1n0vc2 protein/RNA complex; complexed with nad has additional subdomain(s) that are not in the common domain |
PDB Entry: 3b8h (more details), 2.5 Å
SCOPe Domain Sequences for d3b8he1:
Sequence, based on SEQRES records: (download)
>d3b8he1 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp
>d3b8he1 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal lkvvmrkflpaadallemivlhlp
Timeline for d3b8he1:
![]() Domains from same chain: (mouse over for more information) d3b8he2, d3b8he3, d3b8he4, d3b8he5 |