![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fab 4-4-20 (mouse), kappa L chain [48778] (2 PDB entries) |
![]() | Domain d4fabh1: 4fab H:1-118 [19907] Other proteins in same PDB: d4fabh2, d4fabl2 |
PDB Entry: 4fab (more details), 2.7 Å
SCOP Domain Sequences for d4fabh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fabh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain} evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss
Timeline for d4fabh1: