Lineage for d4fabh1 (4fab H:1-118)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7412Species Fab 4-4-20 (mouse), kappa L chain [48778] (2 PDB entries)
  8. 7415Domain d4fabh1: 4fab H:1-118 [19907]
    Other proteins in same PDB: d4fabh2, d4fabl2

Details for d4fabh1

PDB Entry: 4fab (more details), 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

SCOP Domain Sequences for d4fabh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fabh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

SCOP Domain Coordinates for d4fabh1:

Click to download the PDB-style file with coordinates for d4fabh1.
(The format of our PDB-style files is described here.)

Timeline for d4fabh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fabh2