| Class b: All beta proteins [48724] (176 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (10 proteins) |
| Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
| Domain d3b8ha2: 3b8h A:344-481 [199061] Other proteins in same PDB: d3b8ha1, d3b8ha3, d3b8ha4, d3b8ha5, d3b8hb_, d3b8hc1, d3b8hc3, d3b8hc4, d3b8hc5, d3b8hd_, d3b8he1, d3b8he3, d3b8he4, d3b8he5, d3b8hf_ automated match to d1n0vc1 protein/RNA complex; complexed with nad |
PDB Entry: 3b8h (more details), 2.5 Å
SCOPe Domain Sequences for d3b8ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8ha2 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm
Timeline for d3b8ha2:
View in 3DDomains from same chain: (mouse over for more information) d3b8ha1, d3b8ha3, d3b8ha4, d3b8ha5 |